Peptides Synthesis
-
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
$6,664.02 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Gap 27?Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile
$628.98 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
GAP-134 Hydrochloride?Danegaptide Hydrochloride?ZP 1609 Hydrochloride
$1,064.22 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
GHRP-2 metabolite 1?(D-Ala)-(D-beta-Nal)-Ala
$2,380.02 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
GLP-1 moiety from Dulaglitude?HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
$2,380.02 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
GLP-1(7-36)?Human GLP-1-(7-36)-amide?Insulinotropin?MKC253?Glucagon-like Peptide 1 (7-36) amide
$64.62 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
GLP-1(7-37)?HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
$4,757.43 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
GLP-2(1-33)(human)?GLP-2 (human)?Glucagon-like peptide 2 (human)?HADGSFSDEMNTILDNLAARDFINWLIQTKITD
$2,749.77 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Glucagon?Porcine glucagon
$158.97 – $1,244.40 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
GPRP acetate?Gly-Pro-Arg-Pro acetate?Glycyl-L-prolyl-L-arginyl-L-proline acetate?Pefa 6003?Pefabloc FG
$124.08 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
$6,664.02 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Guanosine 5?-[?-thio]diphosphate trilithium salt
$2,371.50 Select options This product has multiple variants. The options may be chosen on the product page Peptides Synthesis
