Peptides Synthesis
-
Deslorelin?H 4065
$454.77 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Disitertide?P144?P144 Peptide
$2,827.08 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Dolastatin 10?DLS 10?NSC 376128
$413.97 – $2,688.57 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Elamipretide?MTP-131?RX-31?SS-31
$4,731.93 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Eledoisin?Eledone peptide
$1,116.90 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Enfuvirtide?Ac-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-Trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe-NH2?Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
$1,252.05 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Eptifibatide?MPA-HAR-Gly-Asp-Trp-Pro-Cys-NH2?{MPA}{HAR}GDWPC-NH2
$83.28 – $255.00 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Exendin derivative 1?HAEGTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
$1,495.98 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Exendin-4 Acetate?Exenatide acetate
$1,403.37 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Fertirelin
$701.25 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
FLAG peptide?DYKDDDDK?Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys
$508.32 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Fmoc-Val-Cit-PAB-PNP
$306.00 – $2,719.98 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry
