Peptides Synthesis
-
thymus peptide C
$2,603.55 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Tos-Gly-Pro-Arg-ANBA-IPA acetate?tos-GPR-ANBA-IPA acetate
$3,400.02 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Tos-Gly-Pro-Arg-ANBA-IPA?tos-GPR-ANBA-IPA
$3,718.77 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
TRAP-6?Ser-Phe-Leu-Leu-Arg-Asn?Thrombin Receptor Activator Peptide 6
$764.13 – $2,538.12 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Triptorelin
$593.28 – $5,071.08 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Tyr-Gly-Gly-Phe-Met-OH?Methionine enkephalin?Met-Enkephalin
$229.50 – $2,045.10 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Vapreotide,RC160,BMY 41606
$601.80 – $1,774.80 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
VIP(6-28)(human, rat, porcine,bovine),FTDNYTRLRKQMAVKKYLNSILN
$423.30 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
$6,664.02 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Weinreb Linker
$44.20 – $1,366.80 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Z-Gly-Gly-Arg-AMC acetate•Z-GGRAMC acetate
$1,360.02 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry -
Z-Gly-Gly-Arg-AMC•Z-GGRAMC
$1,042.08 Select options This product has multiple variants. The options may be chosen on the product page Fine Chemistry
