Categories

Filter by price

Average rating

Peptides Synthesis

Select options
Rated 0 out of 5
thymus peptide C
$2,603.55
Select options
Rated 0 out of 5
Tos-Gly-Pro-Arg-ANBA-IPA acetate?tos-GPR-ANBA-IPA acetate
$3,400.02
Select options
Rated 0 out of 5
Tos-Gly-Pro-Arg-ANBA-IPA?tos-GPR-ANBA-IPA
$3,718.77
Select options
Rated 0 out of 5
TRAP-6?Ser-Phe-Leu-Leu-Arg-Asn?Thrombin Receptor Activator Peptide 6
$764.13 – $2,538.12
Select options
Rated 0 out of 5
Triptorelin
$593.28 – $5,071.08
Select options
Rated 0 out of 5
Tyr-Gly-Gly-Phe-Met-OH?Methionine enkephalin?Met-Enkephalin
$229.50 – $2,045.10
Select options
Rated 0 out of 5
Vapreotide?RC160?BMY 41606
$601.80 – $1,774.80
Select options
Rated 0 out of 5
VIP(6-28)(human? rat? porcine? bovine)?FTDNYTRLRKQMAVKKYLNSILN
$423.30
Select options
Rated 0 out of 5
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
$6,664.02
Select options by Adels Store
Rated 0 out of 5
Weinreb Linker
$44.20 – $1,366.80
Select options
Rated 0 out of 5
Z-Gly-Gly-Arg-AMC acetate?Z-GGRAMC acetate
$1,360.02
Select options
Rated 0 out of 5
Z-Gly-Gly-Arg-AMC?Z-GGRAMC
$1,042.08