Life Science s

Select options
Rated 0 out of 5
AMPA/kainate antagonist-1
$3,832.08
Select options
Rated 0 out of 5
AMPA/kainate antagonist-3
$2,874.13 – $5,747.98
Select options
Rated 0 out of 5
Ampicillin-d5
$577.43
Select options
Rated 0 out of 5
AMPK activator (D942)
$731.28
Select options
Rated 0 out of 5
Amrubicin (AMR)
$1,876.80
Select options
Rated 0 out of 5
Amrubicin hydrochloride (AMR hydrochloride)
$1,046.07
Select options
Rated 0 out of 5
AMT hydrochloride
$340.28
Select options
Rated 0 out of 5
AMTB
$787.67 – $1,411.00
Select options
Rated 0 out of 5
Amylin (8-37)? rat
$700.12
Select options
Rated 0 out of 5
Amyloid ? Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD)
$174.82
Select options
Rated 0 out of 5
Amyloid ?-peptide (1-40) (rat) (DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV)
$366.07
Select options
Rated 0 out of 5
Anavex-2-73 free base (Blarcamesine)
$559.30